PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0104600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 185aa    MW: 20697.9 Da    PI: 9.4718
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0104600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.67.6e-141957543
                       SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
             SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                       +k  r   fskR ++i+ KA+EL +LC++ vav+ +s++
  ORGLA03G0104600.1 19 DKKVRDACFSKRHTTIFNKANELAILCGVMVAVVFVSPN 57
                       56779999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-9868IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.521857IPR002100Transcription factor, MADS-box
CDDcd002666.71E-16969No hitNo description
SuperFamilySSF554551.7E-14986IPR002100Transcription factor, MADS-box
PfamPF003192.7E-151965IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MVKCRARTTR KKIEIKCGDK KVRDACFSKR HTTIFNKANE LAILCGVMVA VVFVSPNANG  60
GIFSFGYPSV SSVANRFLAN APNNTSVSSS TQSGRDVEIR ELEREERELK EHLQASTDQN  120
KLLREAIAAR DGEQLMLLLQ SDCSELGPKG LVAVVRLWFR NSLVGIRLDR LCWLLQQILF  180
GLDWG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1342400.0AC134240.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBb0081I10, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.17e-67PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLI1P9K01e-135I1P9K0_ORYGL; Uncharacterized protein
STRINGORGLA03G0104600.11e-134(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-13AGAMOUS-like 29